ILS
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Arabic Arabic Italy Italy Hebrew Hebrew France France Romania Romania Russia Russia Germany Germany
₪ 0.00
Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull
Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull

Finger Ring Phone Holder Desktop Ultra-Thin Cartoon Rabbit Phone Stand Foldable Buckle Adhesive Pull

₪ 0.00 inc. tax
Specifications
Material: ABS
Category: mobile phone holder
Shape: rabbit
Style: simple
Dimensions: 4*9cm
Applicable: mobile phone, tablet
Package includes: 1 * stand


Product Code: bf956a6f-95cf-4770-a6b7-4bca02c38c0e
weight: 10.0 g
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i