ILS
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Arabic Arabic Italy Italy Hebrew Hebrew France France Romania Romania Russia Russia Germany Germany
₪ 0.00
Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function
Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function

Anti theft, self-defense, anti wolf device alarm, anti robbery, personal alarm, anti wolf function

₪ 0.00 inc. tax

Type of anti wolf device

Volume ≥ 130 (dB)

Lighting function belt

Working voltage 4.5-6 (V)

Working current 100 (mA)

image.png

1.jpg


Product Code: 1404D70060D94C7C9EAC200D144FD354
weight: 50.0 g
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i