ILS
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Arabic Arabic Italy Italy Hebrew Hebrew France France Romania Romania Russia Russia Germany Germany
₪ 0.00
Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc
Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc

Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator for Motoc

₪ 0.00 inc. tax
CARSUN Rechargeable Air Pump Tire Inflator Portable Compressor Digital Cordless Car Tyre Inflator For Bicycle Balls Mobile Power


Product Code: b2ab8702-3db6-43fd-8945-5adf51390de5
weight: 500.0 g
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i